PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00229.1.p
Common NameEUGRSUZ_B00229, LOC104417786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 383aa    MW: 42924.9 Da    PI: 5.6311
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00229.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.B00229.1.p 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                      678*******************************************97 PP

2Myb_DNA-binding49.59.7e-1667110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg +++eE++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.B00229.1.p  67 RGMFSQEEEDLIVSLHKVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                       788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.883961IPR017930Myb domain
SuperFamilySSF466894.87E-2912108IPR009057Homeodomain-like
SMARTSM007174.1E-121363IPR001005SANT/Myb domain
PfamPF002492.5E-141461IPR001005SANT/Myb domain
CDDcd001674.34E-111761No hitNo description
PROSITE profilePS5129425.13862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2565116IPR009057Homeodomain-like
SMARTSM007177.6E-1466114IPR001005SANT/Myb domain
PfamPF002493.8E-1467111IPR001005SANT/Myb domain
CDDcd001675.78E-1170109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MGRHSCCVKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQEEEDLIVS LHKVLGNRWA QIAAQLPGRT DNEIKNFWNS CLKKKLMKQG  120
IDPATHQPIS EVQLIKEEKC AENKSLQVPQ LKGLTPAVSS SRAHEPAFLI SDTCYEGGAL  180
IEPSRESADN NNYMSRPVFD SLPYFEFQSG VDMVGFNSNL LSQYHDPPRT IDQSHLDISS  240
NFEFSSMPSL TNFDHPGATM SGSEFSNNST SRMSPFFFHE AKDQCSTNNS SSIGNYTGFQ  300
VNSSVENAAF SWCSSENKLD CLFQYQANGT SKSEELKPQG SWQEDQLHIG PVNSSSEDFG  360
SFQLTSLSDD LTAANFDIFQ QM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00229.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027307.10.0PREDICTED: protein ODORANT1-like
TrEMBLA0A059CY620.0A0A059CY62_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.19e-83myb domain protein 50